Melanotan II is one of those subjects where the details matter more than the headlines. This page pulls together the background, the mechanisms, and the practical points readers ask about most.
Updated 2026-07-23. Numbers and descriptions here follow the published literature rather than marketing material.
Melanotan-2 appears on the World Anti-Doping Agency prohibited list within the peptide hormone class, and several national regulators treat it as an unapproved prescription substance. Some countries restrict importation or sale for personal use. Because the compound is widely traded as a research chemical, the practical legal picture differs between jurisdictions and shifts over time. Human safety data covering long periods are limited, and whether repeated pigmentation changes carry any lasting risk to melanocytes remains an open question.
Freeze-dried melanotan-2 is normally kept as a desiccated powder at minus twenty degrees Celsius or lower, shielded from light and moisture. Peptides of this size degrade through hydrolysis, oxidation and deamidation, and each pathway accelerates as temperature and water activity rise. Repeated freeze-thaw cycles promote aggregation and loss of material, so aliquoting a stock solution before freezing is standard laboratory practice. Once dissolved, the solution is markedly less stable than the powder. In laboratory work, solutions are generally refrigerated and used within days rather than kept for months.
Regulatory treatment varies between countries. Several national medicines agencies have classified the peptide as unapproved, and customs authorities in some jurisdictions seize shipments on that basis. A few jurisdictions channel supply through prescription-only frameworks that do not list the substance by name. Because the material circulates mainly through online vendors, composition and purity are rarely verified before sale. Surveys of unapproved peptide products have reported labels that did not match measured content in a substantial fraction of samples.
Melanotan II is a synthetic cyclic heptapeptide analogue of alpha-melanocyte-stimulating hormone, a naturally occurring peptide involved in pigmentation signalling. Its structure substitutes a lactam bridge between side chains to increase stability relative to the native hormone. The compound is also known by the shorthand MT-II and by several non-proprietary synonyms used in research catalogues. It is not an approved therapeutic product in any major jurisdiction; material sold under this name is typically offered as a laboratory reagent rather than as a medicine.
Activity is attributed to agonism at melanocortin receptors, particularly MC1R and MC4R. Activation of MC1R on melanocytes increases melanin synthesis, which underlies the reported tanning effect. MC4R engagement in the central nervous system is linked to appetite suppression and to effects on sexual arousal reported in early clinical studies. Those studies were small and were not designed to establish efficacy or long-term safety. Receptor selectivity among the melanocortin subtypes is not absolute, which complicates attribution of any effect to a single pathway.
| Property | Value | Notes |
|---|---|---|
| Typical storage temperature | -20 °C or below | For the lyophilised powder, desiccated |
| Storage form | Sealed vial, protected from light | Amber glass or foil-wrapped containers |
| Reconstituted stability | Short, refrigerate | Degradation accelerates in solution |
| Typical analytical method | Reversed-phase HPLC with mass spectrometry | Purity assessment plus identity confirmation |
| Common synonyms | Melanotan II, MT-II | Also written melanotan-2 |
Routine characterisation relies on reversed-phase high-performance liquid chromatography with ultraviolet detection near 214 nanometres, using a C18 column and a water-acetonitrile gradient containing trifluoroacetic acid. Electrospray ionisation mass spectrometry confirms the expected molecular mass and can reveal truncated or oxidised by-products that co-elute poorly. Sequence and stereochemistry require additional work, such as peptide mapping or amino acid analysis, because a chromatographic purity figure alone does not distinguish a diastereomer from the target peptide. Independent testing of research-grade material frequently shows measured content below the stated label, so a certificate of analysis is best read together with the method that produced it.
Melanotan-2 is handled in the laboratory as a lyophilised powder that dissolves readily in water, dimethyl sulfoxide and dimethylformamide, with limited solubility in ethanol. Stock solutions prepared in an organic solvent often precipitate when diluted into aqueous buffer, so gradual dilution with mixing is standard practice. The peptide carries a tryptophan residue and a histidine residue, both sensitive to oxidation and to alkaline conditions. Working solutions are therefore kept near neutral to slightly acidic pH, protected from light, and consumed within the same working session whenever that is practical.
Solid peptide kept dry at minus twenty degrees Celsius, shielded from light and moisture, is generally considered stable for extended periods. Solutions are divided into single-use aliquots and held at minus twenty or minus eighty degrees Celsius, because repeated freeze-thaw cycles promote aggregation and loss of material to container surfaces. Hydrolysis of the backbone and oxidation of tryptophan are the principal degradation routes in aqueous solution, and both accelerate at ambient temperature. Hygroscopic uptake after a vial is opened can also shift the actual mass weighed, which affects any concentration calculated from it.
Research interest has centred on photoprotection and pigmentation, with a smaller body of work on appetite and sexual function. Published human data remain limited to small, frequently uncontrolled studies, and the compound has never received marketing approval from a national medicines regulator. Most laboratory work treats it as a pharmacological tool for probing melanocortin signalling in cell culture or animal models. Whether pigmentation changes observed in people translate into measurable protection against ultraviolet-induced DNA damage remains an open question.
Melanotan-2 is a synthetic cyclic heptapeptide designed as an analogue of alpha-melanocyte-stimulating hormone, the naturally occurring peptide involved in pigmentation signalling. Its sequence is conventionally written as Ac-Nle-cyclo[Asp-His-D-Phe-Arg-Trp-Lys]-NH2, with a lactam bridge joining the aspartate side chain to the lysine side chain. The empirical formula is C50H69N15O9 and the monoisotopic mass lies near 1023.5 daltons. N-terminal acetylation and the D-configured phenylalanine both increase resistance to enzymatic breakdown compared with the parent hormone.
Pharmacologically, melanotan-2 behaves as a non-selective agonist across the melanocortin receptor family. Binding at MC1R on dermal melanocytes promotes eumelanin synthesis, which underlies the tanning response described in early human work. Activity at the centrally expressed MC4R receptor is associated with reported effects on appetite and erectile function. Because the peptide does not discriminate strongly among receptor subtypes, attributing any single observed effect to one receptor pathway is generally not possible without selective antagonists or receptor knockout models.
Scientific discussion of Melanotan-2 spans pharmacology, dermatology, and public-health literature. Laboratory studies examine its receptor binding and cellular effects, while clinical reports describe outcomes observed after unregulated use. These two bodies of work differ in rigour and intent. Peer-reviewed trials of the compound as a medicine are limited, so much of the available information comes from case reports and surveillance data. Authors frequently note the gap between experimental findings and real-world use.
Reported observations after unregulated use include shifts in skin pigmentation and, in some accounts, unintended changes to moles and other lesions. Whether these outcomes are causally linked to the compound, and how often they occur, remain open questions because controlled data are scarce. The absence of standardised dosing and verified product purity complicates interpretation. Researchers have called for better surveillance and analytical characterisation of samples obtained outside regulated channels. Conclusions drawn from anecdotal evidence should be treated as provisional.
Melanotan-2 has not received marketing authorisation from major regulatory agencies for any therapeutic indication. Several jurisdictions classify it as a prescription-only medicine or a controlled substance when supplied for human use. Because approved products do not exist, material sold online usually sits outside pharmaceutical supply chains and formal quality oversight. Regulators have issued public notices describing the compound as unapproved. Enforcement varies, and the legal position differs between countries, which complicates any single general statement about its status.
In total, 32 radioisotopes have been characterised, which range in mass number from 207 to 238. After 232Th, the most stable of them (with respective half-lives) are 230Th (75,400 years), 229Th (7,916 years), 228Th (1.91 years), 234Th (24.11 days), and 227Th (18.693 days). All of these isotopes occur in nature as trace radioisotopes due to their presence in the decay chains of 232Th, 235U, 238U, and 237Np: the last of these is long extinct in nature due to its short half-life (2.14 million years), but is continually produced in minute traces from neutron capture in uranium ores. 233Th (half-life 22 minutes) occurs naturally as the result of neutron activation of natural 232Th. In deep seawaters the isotope 230Th constitutes up to 0.02% of total thorium. This is because its parent uranium is generally soluble in the ocean, but 232Th is nearly insoluble and is precipitated; thus the isotopes continually produced from uranium is relatively enriched. For this reason International Union of Pure and Applied Chemistry (IUPAC) reclassified thorium as a binuclidic element in 2013; it had formerly been considered a mononuclidic element. Thorium has a nuclear isomer, 229mTh, having the lowest known excitation energy of any isomer, measured to be 7.6±0.5 eV. This is so low that when it undergoes isomeric transition, the emitted gamma radiation is in the ultraviolet range. The nuclear transition from 229Th to 229mTh is being investigated for a nuclear clock.
to improve glycemic control when metformin with or without sulphonylurea (SU) and either saxagliptin or dapagliflozin does not provide adequate glycemic control. when already being treated with saxagliptin and dapagliflozin.
In January 2018, Thaçi said that Kosovo would have supported U.S. president Donald Trump's decision to relocate the U.S. embassy from Tel Aviv to Jerusalem, which would have made it the only Muslim-majority nation to do so. Thaçi told Express that if his country was given full United Nations membership, it would vote "all the time" with the U.S., even on the resolution motioned last month to protest Trump's decision. Thaçi met with Trump on the sidelines of the United Nations General Assembly in September 2017 in New York, inviting him to visit Pristina, the capital of Kosovo. According to local media, he said their meeting was "exceptionally friendly, warm." "The Head of State thanked President Trump for his personal support for Kosovo," his office said in a statement, calling the U.S. a "strategic partner" and saying the support of Washington was "crucial to the peace, stability and overall development of Kosovo and the region." Thaçi told Pristina-based broadcaster RTV21, "President Trump, like all other U.S. presidents, has a clear vision for Kosovo. It is unique support to our country. He said that Kosovo is a wonderful country and that we are a wonderful people." On 26 November 2019, an earthquake struck Albania. President Thaçi was part of a presidential delegation that visited the earthquake epicentre and expressed his condolences on behalf of Kosovo. In 2019 he met with Trump's special envoy Grenell, and in February 2020 signed an agreement with Serbia's president Vučić.
== Journal of Wound Management == The Journal of Wound Management is the official journal of the European Wound Management Association (EWMA). Issues are published in January, May and October. EWMA Journal is CINAHL indexed and provides peer-reviewed original scientific articles, reviews, clinical information, and information about development in wound healing and management across Europe. The Journal also functions as a communication tool between EWMA, its members and the EWMA cooperating Organisations. The Journal is freely available online under terms of the Creative Commons Attribution-NonCommercial 4.0 International (CC BY-NC 4.0) which means that anybody can copy, redistribute in any medium or format, adapt, remix, transform and make indicated changes with appropriate credit. It is prohibited to use the articles for commercial purposes. It is distributed to EWMA members and to members of national wound healing organisations in Europe, as well as to a wider audience via the internet. As a result, each issue of the EWMA Journal is distributed to 12-13,000 nurses, doctors and other health care professionals who have a special interest in wound care.
Gotcha! (1985 film) is a film about a college student named Jonathan (Anthony Edwards) who plays a game called Gotcha in which he hunts and is hunted by other students with paint guns on campus. Jonathan goes to France on vacation, meets a beautiful woman named Sasha (Linda Fiorentino), travels with her to East Germany, and unknowingly becomes involved in the spy game between the US and USSR. The Kremlin Letter is a 1970 American neo-noir espionage thriller set in the winter of 1969–1970, at the height of US-Soviet tensions. No Way Out a 1987 film about a spy myth that is created to cover up the killing of the mistress of a high American official.
Sources: en.wikipedia.org
=== Business ventures === In 1997, Freeman and business partner Lori McCreary founded Revelations Entertainment, a film production company. They also founded ClickStar in 2006, a film download company, with investment from Intel Corporation. ClickStar ceased operations in 2008. Freeman owns and operates Ground Zero, a blues club in Clarksdale, Mississippi; he is the former co-owner of Madidi, a fine dining restaurant in the same city. Clarksdale has a rich history in blues lore. The Ground Zero club is located near the crossroads of Highway 49 and Highway 61, which is where the blues legend Robert Johnson is said to have sold his soul to the devil in exchange for musical talent. It is also the setting of Ryan Coogler's 2025 film "Sinners."
== Generation == PAW is produced through the generation of plasma inside the water to generate the required ions. The interaction between cold atmospheric plasma (CAP) and water modifies the liquid chemical properties through the production of reactive oxygen and nitrogen species (RONS). RONS thus generated fall into two macro groups: long-lived species such as hydrogen peroxide (H2O2), nitrites (NO2−), nitrates (NO3−), ozone (O3), and short-lived species such as hydroxyl radicals (OH·), nitric oxide (NO), superoxide (O2−), and peroxynitrous acid (ONOOH).
== Further reading == Aarhus, R.; Aarhus, R (1995). "A Derivative of NADP Mobilizes Calcium Stores Insensitive to Inositol Trisphosphate and Cyclic ADP-ribose". Journal of Biological Chemistry. 270 (5): 2152–7. doi:10.1074/jbc.270.5.2152. PMID 7836444.
It is a very specific tag that can be used for purification of membrane proteins. S-tag, a peptide derived from Ribonuclease A (KETAAAKFERQHMDS) SBP-tag, a peptide which binds to streptavidin (MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP) Softag 1, for mammalian expression (SLAELLNAGLGGS) Softag 3, for prokaryotic expression (TQDPSRVG) Spot-tag, a peptide recognized by a nanobody (PDRVRAVSHWSS) for immunoprecipitation, affinity purification, immunofluorescence and super resolution microscopy Strep-tag, a peptide which binds to streptavidin or the modified streptavidin called streptactin (Strep-tag II: WSHPQFEK) T7-tag, an epitope tag derived from the T7 major capsid protein of the T7 gene (MASMTGGQQMG). Used in different immunoassays as well as affinity purification Mainly used TC tag, a tetracysteine tag that is recognized by FlAsH and ReAsH biarsenical compounds (CCPGCC) Ty tag (EVHTNQDPLD) V5 tag, a peptide recognized by an antibody (GKPIPNPLLGLDST) VSV-tag, a peptide recognized by an antibody (YTDIEMNRLGK) Xpress tag (DLYDDDDK), a peptide recognized by an antibody
The microscopic structure of liquids is complex and historically has been the subject of intense research and debate. Liquids consist of a dense, disordered packing of molecules. This contrasts with the other two common phases of matter, gases and solids. Although gases are disordered, the molecules are well-separated in space and interact primarily through molecule-molecule collisions. Conversely, although the molecules in solids are densely packed, they usually fall into a regular structure, such as a crystalline lattice (glasses are a notable exception).
Sources: en.wikipedia.org
The Venezuelan Science and Technology Minister Gabriela Jiménez Ramírez shared footage on social media of crumbled buildings of the Venezuelan Institute for Scientific Research (IVIC) in La Guaira which she attributed to strikes of AGM-154 glide bombs by the United States. The Venezuelan government said that Maduro declared a national state of emergency after the explosions began. The Venezuelan government promised to defend against US military actions which it accused of seeking regime change. It described them as "imperialist aggression" and called for the United Nations Security Council (UNSC) to be convened.
== Research == Research on the bioactive properties of Parmotrema perlatum has revealed several findings. The methanol extract of this species has been shown to significantly reduce blood glucose levels in streptozotocin-induced diabetic rats, attributed to its inhibitory activity on alpha-glucosidase rather than an effect on insulin secretion. This extract also has a high phenolic content and moderate antioxidant capacity, which could help prevent secondary complications of diabetes. The antioxidant potential and free radical-scavening activity of P. perlatum extracts has been further demonstrated through various chemical assays. Additionally, Parmotrema perlatum has some antimicrobial properties. The crude polysaccharide fraction of this lichen demonstrated antibacterial activity against Escherichia coli and Staphylococcus aureus, which are common pathogens in diabetic foot ulcers. Furthermore, extracts from this species showed significant antiviral activity against the yellow fever virus envelope. Tests against the Gram-negative bacteria Pseudomonas aeruginosa, Chromobacterium violaceum, and Gram-positive Lactobacillus plantarum showed that the methanol extract had the highest antibacterial activity among the three solvent extracts evaluated. In terms of cytotoxic and anticancer activities, the n-hexane, diethyl ether, and methanol extracts of Parmotrema perlatum have been studied against various cancer cell lines, with the n-hexane extract showing the highest cytotoxic effects.
Great consumption of fresh produce, especially cut fruits and vegetables. Wider distribution. Improved electronic reporting of outbreaks. An aging population more susceptible to foodborne illness. Unlike meat, which can be rid of bacteria through proper cooking, fresh produce is often meant to be consumed raw.
Gwen Chambers (Rose Abdoo) is a cancer patient who befriends and advises Kristina when Kristina is diagnosed with cancer. Gwen suffers a relapse of cancer and dies around the end of season 5. Kristina names the school she starts "Chambers Academy" in her honor. Dr. Bedsloe (Kurt Fuller) is the physician who performs Kristina's lumpectomy, recommends chemotherapy, and routinely checks up on her to see if the cancer is progressing or if she is cancer-free. Ruby Rizzoli (Courtney Grosbeck) is Hank Rizzoli's daughter, who is 14 in season 5. Sandy Rizzoli (Betsy Brandt) is Hank Rizzoli's former wife and the mother of Ruby Rizzoli. Oliver Rome (Tyson Ritter) is a musician who works for a fictional label in the show. He has his own band called Ashes of Rome. He is often egotistical and hotheaded. Carl Fletcher (Josh Stamberg) is a tenant in the building where Sarah Braverman lives and works as a super in season 5. Carl and Sarah have a brief relationship. Meredith Peet (Sonya Walger), known simply as "Peet", is the architect who hires Joel and his construction crew in season 5. Ed Brooks (David Denman) is a parent at the school Sydney and Victor Graham attend, who is on the sustainability committee with Julia. Their friendship starts to turn into an emotional affair that starts to get complicated when Ed kisses Julia, causing Joel to leave her. Heather Hall (Jurnee Smollett-Bell) is a smart and feisty up-and-coming political campaign adviser whom Kristina hires to be her campaign manager in season 5. Chad “Berto” Roberto (Nick Krause) is Drew's college roommate in season 5.
== External links == Skin graft. MedlinePlus Medical Encyclopedia. Parts of this US Federal Government public domain text were used in the article. An introduction to the use of vacuum assisted closure.
Sources: en.wikipedia.org
The lyophilised solid is best kept cold, dry and dark, typically at minus twenty degrees Celsius. Moisture and repeated warming cycles are the main causes of degradation. Solutions prepared from the powder are less stable and are normally used quickly.
Reversed-phase liquid chromatography assesses purity, while mass spectrometry confirms molecular mass and detects sequence errors. Amino acid analysis and peptide mapping add structural detail. These techniques are complementary rather than interchangeable.
It is listed as a prohibited peptide hormone by the World Anti-Doping Agency. No medicines regulator has approved it for human use. Import and sale rules vary by country.
No. No major regulatory agency has granted a marketing authorisation for melanotan II as a medicine. Products sold under this name are generally presented as laboratory reagents and are not subject to the batch-release testing applied to approved drugs.