If you have been reading about melanotan-2 and want a single page that covers the useful parts, this is it: definitions, context, how it is studied, and the questions that come up repeatedly.
Updated 2026-02-01. Numbers and descriptions here follow the published literature rather than marketing material.
Melanotan-2 is a synthetic cyclic heptapeptide designed as an analogue of alpha-melanocyte-stimulating hormone. Its sequence incorporates a lactam bridge that constrains the peptide into a ring, which increases resistance to enzymatic breakdown relative to the natural hormone. Researchers at the University of Arizona synthesised the compound in the late 1980s and early 1990s while studying pigmentation pathways. It has never received marketing approval from any national medicines regulator. In the scientific literature it is usually described as a laboratory research reagent rather than a therapeutic product.
The peptide acts as a non-selective agonist at melanocortin receptors, showing affinity for MC1R, MC3R, MC4R and MC5R. Activation of MC1R on melanocytes drives the conversion of tyrosine into melanin and shifts production toward the darker eumelanin form. MC4R signalling in the central nervous system is linked to appetite and energy balance, which helps explain why reduced food intake appeared in early human studies. Effects on MC4R and on vascular tone also account for the erectile responses recorded as unexpected findings in those same trials.
Receptor studies place melanotan-2 among non-selective melanocortin agonists, binding MC1R, MC3R, MC4R and MC5R rather than a single subtype. Activation of MC1R on cutaneous melanocytes raises tyrosinase activity and shifts pigment synthesis toward eumelanin, which is darker and more photostable than pheomelanin. Central receptors, particularly MC4R, are associated with appetite suppression and with reported effects on sexual function. Because subtype selectivity is low, the same molecule engages pigment, metabolic and vascular pathways at once, and this breadth is a common explanation offered for the range of adverse events described in user reports.
No regulatory authority has approved melanotan-2 for human use, and several countries classify it as a prescription-only or controlled substance, which restricts lawful supply. Material sold online is generally labelled as a research chemical and is not required to meet pharmaceutical standards of identity or purity. Published human data consist mainly of small uncontrolled studies, case reports and adverse-event notifications, so the evidence base is descriptive rather than confirmatory. Whether repeated melanocyte stimulation alters long-term naevus behaviour remains an open question that no completed trial has resolved.
Melanotan-2 is a synthetic cyclic heptapeptide designed as a structural analogue of alpha-melanocyte-stimulating hormone, the endogenous tridecapeptide that regulates pigment production. Two modifications distinguish it from the natural hormone: norleucine replaces methionine at the N-terminus, which limits oxidation, and a D-phenylalanine substitution raises receptor affinity. The ring is closed through an aspartate-lysine lactam bridge, giving the molecule a constrained conformation. The free base has a molecular mass near 1024 daltons, and commercial material is usually supplied as an acetate salt. It appears in the literature as a research peptide rather than an approved therapeutic agent.
| Property | Value | Notes |
|---|---|---|
| Chemical class | Synthetic cyclic heptapeptide | Alpha-MSH analogue with a lactam ring |
| Molecular formula | C50H69N15O9 | Commonly cited value for the neutral peptide |
| Molecular weight | 1024.18 g/mol | Calculated for the free molecule |
| Appearance | White to off-white powder | Typically supplied as a lyophilised solid |
| Solubility | Soluble in water, DMSO and ethanol | Dissolution in pure water is often slow |
Structurally, Melanotan-2 retains the core recognition motif of alpha-melanocyte-stimulating hormone while adding a lactam bridge that links two side chains and constrains the molecule into a ring. This modification lowers susceptibility to enzymatic degradation. The compound acts as an agonist at melanocortin receptors, particularly subtypes associated with melanin production. Because the same receptor family influences several physiological processes, researchers note that its activity is not confined to pigmentation alone. Receptor selectivity continues to be examined in published studies.
Melanotan-2 is a synthetic cyclic heptapeptide designed as an analogue of alpha-melanocyte-stimulating hormone, a naturally occurring peptide involved in pigmentation signalling. Its sequence incorporates modified residues that increase potency and extend biological activity relative to the native hormone. The compound binds receptors of the melanocortin family and is examined mainly in laboratory research. It does not occur naturally and exists only as a manufactured chemical entity produced by solid-phase synthesis.
The peptide was developed during the 1980s by researchers investigating melanocortin signalling and skin pigmentation pathways. Early work focused on analogues of alpha-melanocyte-stimulating hormone that would resist enzymatic breakdown more effectively than the parent molecule. Melanotan-2 emerged from that programme as a shortened, cyclised variant. Reports describing its synthesis and receptor activity later appeared in the scientific literature. Commercial availability grew through unregulated channels rather than through pharmaceutical approval.
Early published reports described melanotan-2 as a tanning agent without sun protection, which means darkening is not the same as protection against ultraviolet radiation. Later studies explored the peptide in erectile dysfunction, hemorrhagic shock, and some skin conditions. No regulator in the United States or Europe has approved it for clinical use. Many products labelled melanotan-2 are sold without approval and their identity and purity are unverified. Its long-term safety in humans remains an open question.
Melanotan-2, also written Melanotan II, is a synthetic cyclic heptapeptide designed as an analogue of alpha-melanocyte-stimulating hormone. Its sequence is Ac-Nle-cyclo[Asp-His-D-Phe-Arg-Trp-Lys]-NH2, and the lactam bridge between the aspartate and lysine side chains constrains the peptide into a ring. This structural change increases receptor affinity and metabolic stability relative to the native hormone. The compound was created in the 1980s as a research tool for studying pigmentation biology.
Activity is attributed to agonism at melanocortin receptors, particularly MC1R and MC4R. Activation of MC1R on melanocytes increases melanin synthesis, which underlies the reported tanning effect. MC4R engagement in the central nervous system is linked to appetite suppression and to effects on sexual arousal reported in early clinical studies. Those studies were small and were not designed to establish efficacy or long-term safety. Receptor selectivity among the melanocortin subtypes is not absolute, which complicates attribution of any effect to a single pathway.
Regulatory treatment varies between countries. Several national medicines agencies have classified the peptide as unapproved, and customs authorities in some jurisdictions seize shipments on that basis. A few jurisdictions channel supply through prescription-only frameworks that do not list the substance by name. Because the material circulates mainly through online vendors, composition and purity are rarely verified before sale. Surveys of unapproved peptide products have reported labels that did not match measured content in a substantial fraction of samples.
Melanotan II is a synthetic cyclic heptapeptide analogue of alpha-melanocyte-stimulating hormone, a naturally occurring peptide involved in pigmentation signalling. Its structure substitutes a lactam bridge between side chains to increase stability relative to the native hormone. The compound is also known by the shorthand MT-II and by several non-proprietary synonyms used in research catalogues. It is not an approved therapeutic product in any major jurisdiction; material sold under this name is typically offered as a laboratory reagent rather than as a medicine.
Melanotan-2 is a synthetic cyclic heptapeptide designed as an analogue of alpha-melanocyte-stimulating hormone, the naturally occurring peptide involved in pigmentation signalling. Its sequence is conventionally written as Ac-Nle-cyclo[Asp-His-D-Phe-Arg-Trp-Lys]-NH2, with a lactam bridge joining the aspartate side chain to the lysine side chain. The empirical formula is C50H69N15O9 and the monoisotopic mass lies near 1023.5 daltons. N-terminal acetylation and the D-configured phenylalanine both increase resistance to enzymatic breakdown compared with the parent hormone.
Pharmacologically, melanotan-2 behaves as a non-selective agonist across the melanocortin receptor family. Binding at MC1R on dermal melanocytes promotes eumelanin synthesis, which underlies the tanning response described in early human work. Activity at the centrally expressed MC4R receptor is associated with reported effects on appetite and erectile function. Because the peptide does not discriminate strongly among receptor subtypes, attributing any single observed effect to one receptor pathway is generally not possible without selective antagonists or receptor knockout models.
The most widely used method to determine absolute molar mass is size-exclusion chromatography (SEC) coupled with multi-angle laser light scattering (MALS). SEC can separate macromolecules based on their size by passing an analyte containing molecules of different sizes through a column containing porous substrate. Larger components of the analyte spend less time traveling through these pores and therefore elute faster, while smaller components can access more of these pores and are therefore retained longer. However, molar masses determined through SEC require calibration curves constructed from standards, and calculating absolute molar masses require absolute detection systems. The two primary detection systems used to determine absolute molar mass are light scattering photometers and viscometers. Static light scattering (SLS) experiments measure the difference between the light scattered by a dilute solution and the light scattered through pure solvent. Given a dilute enough solution and at an angle of θ = 0° between the incident light and the scattering direction, this difference, known as the excess Rayleigh ratio ΔR(θ), can be approximately related to the weight-average molar mass Mw through the equation:
A carboxylic acid has the general formula R-C(O)OH, where R is an organic radical. The carboxyl group -C(O)OH contains a carbonyl group, C=O, and a hydroxyl group, O-H. Acetic acid (CH3COOH) Citric acid (C6H8O7) Formic acid (HCOOH) Gluconic acid HOCH2-(CHOH)4-COOH Lactic acid (CH3-CHOH-COOH) Oxalic acid (HOOC-COOH) Tartaric acid (HOOC-CHOH-CHOH-COOH) Halogenation at alpha position increases acid strength, so that the following acids are all stronger than acetic acid. Fluoroacetic acid Trifluoroacetic acid Chloroacetic acid Dichloroacetic acid Trichloroacetic acid Normal carboxylic acids are the direct union of a carbonyl group and a hydroxyl group. In vinylogous carboxylic acids, a carbon-carbon double bond separates the carbonyl and hydroxyl groups. Ascorbic acid Deoxyribonucleic acid (DNA) Ribonucleic acid (RNA) Listing of strengths of common acids and bases Zumdahl, Steven S. (1997). Chemistry (4th ed.). Boston: Houghton Mifflin. ISBN 9780669417944. Pavia, D. L.; Lampman, G. M.; Kriz, G. S. (2004). Organic Chemistry Volume I. Mason, OH: Cengage Learning. ISBN 0759347271.
The Bergmann azlactone peptide synthesis is a classic organic synthesis process for the preparation of dipeptides. In the presence of a base, peptides are formed by aminolysis of N-carboxyanhydrides of amino acids with amino acid esters (1). This reaction can be looked at in further detail by Bailey. The resulting peptide is then protected by esters of benzylchroroformate in order to keep the amino groups intact (2). This mechanism serves as a source of protection for the amino group in the amino acid. The ester will block the amino group from binding with other molecules. The last step in this reaction is the cyclization of the N-haloacylamino acids with an acetanhydride. This will result in the expected azlactone (3). The reaction with a second amino acid allows for the ring to open, later forming an acylated unsaturated dipeptide. The reaction happens in a step-wise function which allows for the amino group to be protected and the azlactone to be produced. Catalytic hydrogenation and hydrolysis then take place in order to produce the dipeptide (4).
The MT-ND6 product is a subunit of the respiratory chain Complex I that is believed to belong to the minimal assembly of core proteins required to catalyze NADH dehydrogenation and electron transfer to ubiquinone (coenzyme Q10). Initially, NADH binds to Complex I and transfers two electrons to the isoalloxazine ring of the flavin mononucleotide (FMN) prosthetic arm to form FMNH2. The electrons are transferred through a series of iron-sulfur (Fe-S) clusters in the prosthetic arm and finally to coenzyme Q10 (CoQ), which is reduced to ubiquinol (CoQH2). The flow of electrons changes the redox state of the protein, resulting in a conformational change and pK shift of the ionizable side chain, which pumps four hydrogen ions out of the mitochondrial matrix.
Sources: en.wikipedia.org
γ-Aminobutyric acid (GABA) prodrugs include progabide and tolgabide. Picamilon (N-nicotinoyl-GABA) has been claimed to be a prodrug of GABA, but has not actually been demonstrated to be converted into GABA. N-Benzoyl-GABA is of very similar chemical structure as picamilon and has also been claimed to be a prodrug of GABA, but this remains unclear similarly. Pivagabine (N-pivaloyl-GABA) was once thought to be a prodrug of GABA, but this proved not to be the case. Cetyl-GABA (GABA cetyl ester) is another prodrug of GABA. 4-Amino-1-butanol is known to be converted into GABA through the actions of aldehyde reductase (ALR) and aldehyde dehydrogenase (ALDH). 4-Amino-1-butanol is to GABA as 1,4-butanediol (4-hydroxy-1-butanol; 1,4-BD) is to γ-hydroxybutyric acid (GHB) (with 1,4-BD being a well-known prodrug of GHB). The metabolic intermediate γ-aminobutyraldehyde (GABAL) is also converted into GABA. A number of γ-hydroxybutyric acid (GHB) prodrugs are known. These include 1,4-butanediol (1,4-BD) and γ-butyrolactone (GBL), as well as the metabolic intermediate γ-hydroxybutyraldehyde (GHBAL).
Carbohydrate synthesis is a sub-field of organic chemistry concerned with generating complex carbohydrate structures from simple units (monosaccharides). The generation of carbohydrate structures usually involves linking monosaccharides or oligosaccharides through glycosidic bonds, a process called glycosylation. Therefore, it is important to construct glycosidic linkages that have optimum molecular geometry (stereoselectivity) and the stable bond (regioselectivity) at the reaction site (anomeric centre).
Closer Roberto Osuna converted his 25th consecutive save on May 24, breaking a club record. The streak had started the previous August 18, surpassing Brad Lidge (24 consecutive from June 21–September 28, 2005). Osuna's feat remained the franchise longest until Josh Hader converted 29 consecutive from April 7 to August 29, 2024. On May 28, A. J. Hinch obtained his 500th win as manager, as the Astros toppled the Chicago Cubs, 9–6. Chicago blasted five home runs, but Houston answered with five doubles—two by Jake Marisnick (8)—and two home runs by Alex Bregman (17). Bregman collected three RBI, and Michael Brantley had two hits and two RBI as Houston scored four times in the bottom of the fourth. Josh James (2–0) picked up the victory in relief while surrendering three runs over 2+1⁄3 frames. With injuries stacking up, on May 29 shortstop Carlos Correa sustained a bruised rib during a massage session. He was forced to join fellow All-Stars Springer and Jose Altuve on the injured list (IL) and expected to miss four to six weeks.
Dietary supplement companies aggressively promote NMN products claiming these benefits. NMN is a precursor to NAD+ biosynthesis, and dietary NMN supplementation has been shown to increase NAD+ concentrations and thus has the potential to mitigate aging-related disorders such as oxidative stress, DNA damage, neurodegeneration, and inflammatory responses. The potential benefits and risks of NMN supplementation as of 2023 are currently under study. Life extension Anti-aging movement
The Streptavidin-Binding Peptide (SBP)-Tag is a 38-amino acid sequence that may be engineered into recombinant proteins. Recombinant proteins containing the SBP-Tag bind to streptavidin and this property may be utilized in specific purification, detection or immobilization strategies. The sequence of the SBP tag is MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP. The Streptavidin-Binding Peptide was discovered within a library of seven trillion stochastically generated peptides using the in vitro selection technique of mRNA Display. Selection was performed by incubating with streptavidin-agarose followed by elution with biotin. The SBP-Tag has been shown to bind streptavidin with an equilibrium dissociation constant of 2.5nM and is readily eluted with biotin under native conditions.
Sources: en.wikipedia.org
It is a synthetic cyclic heptapeptide modelled on alpha-melanocyte-stimulating hormone. A lactam bridge links two side chains, forming a ring that stabilises the molecule against proteolysis. It belongs to the broader melanocortin peptide family.
No national medicines agency has approved melanotan-2 for clinical use. Afamelanotide, a related but distinct peptide, holds a marketing authorisation in the European Union for a rare photosensitivity disorder. Melanotan-2 itself is handled as a laboratory chemical.
Its broad activity across melanocortin receptors makes it a tool for probing pigmentation, appetite and vascular signalling. Early trials recorded skin darkening and other effects that were not the original focus of the work. Those observations generated hypotheses that later studies have examined.
No regulatory agency has authorised melanotan-2 as a medicine for any indication. It circulates mainly as a research chemical or through unregulated channels. As a result, identity, purity and content are not independently guaranteed.